Web stats for Volkswagencampervanweddinghire - volkswagencampervanweddinghire.com
2.20 Rating by ClearWebStats
volkswagencampervanweddinghire.com is 5 years 6 months 11 hours old. It has a .com as an domain extension. This domain is estimated value of $ 8.95 and has a daily earning of $ 0.15. While no active threats were reported recently by users, volkswagencampervanweddinghire.com is SAFE to browse.
Traffic Report of Volkswagencampervanweddinghire
Daily Unique Visitors: | Not Applicable |
Daily Pageviews: | Not Applicable |
Estimated Valuation
Income Per Day: | $ 0.15 |
Estimated Worth: | $ 8.95 |
Search Engine Indexes
Google Indexed Pages: | Not Applicable |
Yahoo Indexed Pages: | Not Applicable |
Bing Indexed Pages: | Not Applicable |
Search Engine Backlinks
Google Backlinks: | Not Applicable |
Bing Backlinks: | Not Applicable |
Alexa BackLinks: | Not Applicable |
Safety Information
Google Safe Browsing: | No Risk Issues |
Siteadvisor Rating: | Not Applicable |
WOT Trustworthiness: | Not Applicable |
WOT Privacy: | Not Applicable |
WOT Child Safety: | Not Applicable |
Website Ranks & Scores
Google Pagerank: | Not Applicable |
Alexa Rank: | Not Applicable |
Domain Authority: | Not Applicable |
Google Pagerank
PR 0 out of 10
PageSpeed Score
0
Siteadvisor Rating
Not Applicable
Where is volkswagencampervanweddinghire.com server located?
Social Engagement
Facebook Shares: | Not Applicable |
Facebook Likes: | Not Applicable |
Facebook Comments: | Not Applicable |
Twitter Count (Tweets): | Not Applicable |
Linkedin Shares: | Not Applicable |
Delicious Shares: | Not Applicable |
Page Resources Breakdown
Homepage Links Analysis
Website Inpage Analysis
H1 Headings: | 2 | H2 Headings: | Not Applicable |
H3 Headings: | Not Applicable | H4 Headings: | Not Applicable |
H5 Headings: | Not Applicable | H6 Headings: | Not Applicable |
Total IFRAMEs: | Not Applicable | Total Images: | 2 |
Google Adsense: | Not Applicable | Google Analytics: | Not Applicable |
Websites Hosted on Same IP (i.e. 162.255.119.192)
dajaxproject.com - easy to use ajax libraries for django
- dajaxproject.com
Easy to use ajax libraries for django
thesitdownsocialclub.com - Registered at Namecheap.com
- thesitdownsocialclub.com
bibiclinicalresearch.com - Registered at Namecheap.com
- bibiclinicalresearch.com
HTTP Header Analysis
Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Server: nginx
Date: Thu, 22 Nov 2018 08:18:57 GMT
Content-Type: text/html; charset=utf-8
Transfer-Encoding: chunked
Connection: keep-alive
Keep-Alive: timeout=15
Cache-Control: no-cache
Pragma: no-cache
Expires: -1
X-CST: MISS
Allow: GET, HEAD
Status-Code: 200
Status: 200 OK
Server: nginx
Date: Thu, 22 Nov 2018 08:18:57 GMT
Content-Type: text/html; charset=utf-8
Transfer-Encoding: chunked
Connection: keep-alive
Keep-Alive: timeout=15
Cache-Control: no-cache
Pragma: no-cache
Expires: -1
X-CST: MISS
Allow: GET, HEAD
Domain Information for volkswagencampervanweddinghire.com
Domain Nameserver Information
DNS Record Analysis
Host | Type | TTL | Extra |
---|---|---|---|
volkswagencampervanweddinghire.com | A | 1793 |
IP:162.255.119.192 |
volkswagencampervanweddinghire.com | NS | 1799 |
Target:dns1.registrar-servers.com |
volkswagencampervanweddinghire.com | NS | 1799 |
Target:dns2.registrar-servers.com |
volkswagencampervanweddinghire.com | SOA | 3600 |
MNAME:dns1.registrar-servers.com RNAME:hostmaster.registrar-servers.com Serial:2018102501 Refresh:43200 Retry:3600 Expire:604800 |
volkswagencampervanweddinghire.com | MX | 1799 |
Priority:10 Target:eforward2.registrar-servers.com |
volkswagencampervanweddinghire.com | MX | 1799 |
Priority:15 Target:eforward4.registrar-servers.com |
volkswagencampervanweddinghire.com | MX | 1799 |
Priority:10 Target:eforward3.registrar-servers.com |
volkswagencampervanweddinghire.com | MX | 1799 |
Priority:10 Target:eforward1.registrar-servers.com |
volkswagencampervanweddinghire.com | MX | 1799 |
Priority:20 Target:eforward5.registrar-servers.com |
volkswagencampervanweddinghire.com | TXT | 1799 |
TXT:v=spf1 include:spf.efwd.registrar-servers.com ~all |
Similarly Ranked Websites to Volkswagencampervanweddinghire
- google.com
Search the world's information, including webpages, images, videos and more. Google has many special features to help you find exactly what you're looking for.
Google Calendar - Sign in to Access & Edit Your Schedule
- calendar.google.com
Access Google Calendar with a Google account (for personal use) or Google Workspace account (for business use).
Gmail
- mail.google.com
Gmail is email that’s intuitive, efficient, and useful. 15 GB of storage, less spam, and mobile access.
Android Apps on Google Play
- play.google.com
Enjoy millions of the latest Android apps, games, music, movies, TV, books, magazines & more. Anytime, anywhere, across your devices.
Google Chrome - Download the Fast, Secure Browser from Google
- chrome.google.com
Get more done with the new Google Chrome. A more simple, secure, and faster web browser than ever, with Google’s smarts built-in. Download now.
Full WHOIS Lookup for volkswagencampervanweddinghire.com
Domain Name: VOLKSWAGENCAMPERVANWEDDINGHIRE.COM
Registry Domain ID: 2325667249_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.namecheap.com
Registrar URL: http://www.namecheap.com
Updated Date: 2018-10-25T09:25:43Z
Creation Date: 2018-10-25T09:25:40Z
Registry Expiry Date: 2019-10-25T09:25:40Z
Registrar: NameCheap, Inc.
Registrar IANA ID: 1068
Registrar Abuse Contact Email: [email protected]
Registrar Abuse Contact Phone: +1.6613102107
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Name Server: DNS1.REGISTRAR-SERVERS.COM
Name Server: DNS2.REGISTRAR-SERVERS.COM
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of whois database: 2018-11-22T08:18:45Z
Registry Domain ID: 2325667249_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.namecheap.com
Registrar URL: http://www.namecheap.com
Updated Date: 2018-10-25T09:25:43Z
Creation Date: 2018-10-25T09:25:40Z
Registry Expiry Date: 2019-10-25T09:25:40Z
Registrar: NameCheap, Inc.
Registrar IANA ID: 1068
Registrar Abuse Contact Email: [email protected]
Registrar Abuse Contact Phone: +1.6613102107
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Name Server: DNS1.REGISTRAR-SERVERS.COM
Name Server: DNS2.REGISTRAR-SERVERS.COM
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of whois database: 2018-11-22T08:18:45Z